118997-30-1

Basic information

• Product Name: PEPTIDE YY, HUMAN
• Synonyms: H-TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;PEPTIDE YY PYY HUMAN;PEPTIDE TYROSINE TYROSINE, HUMAN;PEPTIDE YY, HUMAN;PYY (HUMAN);TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• CAS NO: 118997-30-1
• Molecular Formula: C194H295N55O57
• Molecular Weight: 4309.7524
• Product Categories: Peptide;Neuropeptide Y (NPY ) receptor
• Mol File: 118997-30-1.mol
• Article Data: 0

Chemical Properties

• Appearance: /
• Storage Temp.: −20°C
• CAS DataBase Reference: PEPTIDE YY, HUMAN(CAS DataBase Reference)
• NIST Chemistry Reference: PEPTIDE YY, HUMAN(118997-30-1)
• EPA Substance Registry System: PEPTIDE YY, HUMAN(118997-30-1)

Safety Data

• WGK Germany: 3
• Hazardous Substances Data: 118997-30-1(Hazardous Substances Data)

Usage

Description

Peptide YY, Human (PYY) is a 36-amino acid peptide hormone secreted by mucosal L cells in the distal ileum, colon, and rectum. It plays a crucial role in regulating gastrointestinal motility, appetite, and energy homeostasis. The gene encoding PYY is localized on human chromosome 17q21.1.

Uses

Used in Cell Culture Applications:
Peptide YY, Human is used as a supplement in Roswell Park Memorial Institute medium (RPMI medium) for culturing pancreatic duct-derived cells. This application aids in the growth and maintenance of these cells in vitro, providing essential nutrients and promoting cell viability.
Used in Pharmaceutical Industry:
PYY is used as a therapeutic agent for the treatment of obesity and related metabolic disorders. It has been shown to reduce appetite and food intake, leading to weight loss and improved metabolic health.
Used in Research:
Peptide YY, Human is used in research studies to investigate its role in gastrointestinal function, appetite regulation, and energy balance. It serves as a valuable tool for understanding the underlying mechanisms of these processes and for developing novel therapeutic strategies for related disorders.
Used in Diagnostics:
PYY can be used as a biomarker for various gastrointestinal disorders, including inflammatory bowel disease, irritable bowel syndrome, and gastrointestinal cancers. Its measurement in blood or tissue samples can help in the diagnosis, prognosis, and monitoring of these conditions.

Biochem/physiol Actions

Gut hormone that inhibits both secretin and cholecystokinin-stimulated pancreatic secretion. Endogenous nonselective agonist at NPY receptors.